McDonnell Genome Institute

Washington University

CircRNA

chr5|134675044|134676125|+|SEC24A|ENST00000322887.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9085

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

3

Peptide

DLVTPLGANHLTTSMSGLSLQPEGLR

Amino Acids from 5' Exons

TPLGANHLTTSMSGLSLQPEGLRVVNLLQERNMLPSTPLKPPVPNLHEDIQKLNCNP,LPVLIIPQAVDVYNQRVELSIFFKKETCFRQHLSLQFQICMKTSRNSTVTQ,SLRCSFNHKHEWIKSTTRGSKSCQSSSRKKHASVNTFEASSSKFARHPETQLPR

Amino Acids from 3' Exons

VISMHADHSSDAGLIESQTSFGAAASSFQRLS,LFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLV,YFDARLAFLRRRPYIKPNFLWGCCFILSKT