McDonnell Genome Institute

Washington University

CircRNA

chr5|134200334|134202021|-|PPP2CA|ENST00000481195.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9238

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

AHQLVMEVR

Amino Acids from 5' Exons

GPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVME,VQCVTCCGQIQMTVVVGVYLLEELVTPLGKIFLRHLIMPMASRWCLELTSW,SNVLAVVRSRPWWLGYISSRSWLHLWARYFDISCQWPHVGVSSPASDG

Amino Acids from 3' Exons

VRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQ,FVTVNASPFFEGIMRADRSHKFMVSMMNVENMEMQMFGNILQIFLTIFLSLPWWMG,SLPTHHHSSRESEQTDHTSLWFLMFKKIWKCKCLEIFYRSFLSSSHCLGGWA