McDonnell Genome Institute

Washington University

CircRNA

chr5|133312653|133316652|-|FSTL4|ENST00000265342.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

EFYMAFR

Amino Acids from 5' Exons

HVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYMAF,MCRSRTWMKTYLVAHQVTSSDLTITTVTAPPSASSTWPS,CAEEAGPGRLTWLLTRPPPIRLQQQLPDPPRVLHGL

Amino Acids from 3' Exons

VTRAPWPATPARMSFWHSRPVCSHSKKETADKTLPPRSASWWNLCSGTMQMAMATSAAPNWL,HVHHGRLRPLEECPSGTPDPSAATPRRRQQTRPCLPEAPPGGISVQGLRCRWQWPPQQLRTGS,DTCTMAGYARLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVESLFRDLDADGNGHLSSSELAQ