McDonnell Genome Institute

Washington University

CircRNA

chr5|133092699|133096250|+|HSPA4|ENST00000304858.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9622

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

EMLNLYIENEK

Amino Acids from 5' Exons

KMQVDQEEPHVEEQQQQTPAENKAESEEME,RCKWTRRNHMLKSNSSRHQQKIRQSLKKW,DASGPGGTTCRATAADTSRKGRVRNG

Amino Acids from 3' Exons

TSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIENE,PLKLDPRIKRWTNHPKPRRQKRPVLWTCQSRISYYGRTERCSTCTLKM,LSSWIQGKDGPTTPSQEGKSEDQYCGPANRESAIMADRQRDAQLVHK