McDonnell Genome Institute

Washington University

CircRNA

chr5|132760801|132761265|-|SEPT8|ENST00000296873.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9686

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

KNLQETYEAK

Amino Acids from 5' Exons

LHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDKK,SMRSLSTSGSTRRRSARWRKSAGNWRRRPTPSIAGRLRWRPCSRRPCTPPRSSPGRTRTRR,PEVAPEAGPPGGEAQGGGKAPGTGGGDQRLQSPEGCGGGPAVAGLARHLAAAPEEGQGQEE

Amino Acids from 3' Exons

PTRDIRGQEEGVPKAAEEGGRDEADVCQQSEGDRAGAEGEGKG,LQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERE,YKRHTRPRGRSSVSCRGRRKRGRCLSTKRRQSWSRRRKG