McDonnell Genome Institute

Washington University

CircRNA

chr5|132595572|132618294|+|RAD50|ENST00000378823.7

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9623

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

3

Peptide

TLDHHAGWSHSSLLPVHYSANR

Amino Acids from 5' Exons

PCWLEPQQFTPSSLLSQTKTSHVAPFVREFFRQRLSYKKSSVICSLNCDLLQINSSQQNQSKKRKSGVMKCWDLCP,HAGWSHSSLLPVHYSANRRKPVMLPRLSESFSDRGVTRSHQFAVTATCSRTQVNRIRAKKKGKAANAGTCAHE,MLAGATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKLKSTESELKKKEKRRDEMLGLVPM

Amino Acids from 3' Exons

TSEVGREHRQYKKKSFGIRATERLRRNYSFERTSRTTISGCGKVRNDDCYEDNRTCEQGSGYLLDSP,EHQKLEENIDNIKRNHNLALGRQKGYEEEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLD,NIRSWKRTTIKEIIIWHGDRKVMKKKLFILRKNFENHNFGMLRKSIEKLLGQQNLTRIWIFIIRLLT