McDonnell Genome Institute

Washington University

CircRNA

chr5|131492581|131548190|-|RAPGEF6|ENST00000296859.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9505

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

GDQVENAK

Amino Acids from 5' Exons

KMNGHLRLLNIACAAKAKWRQVVLQKASRESPLQFSLNGGSEKGFGIFVEGVEPGSKAADSGLKRGDQ,RMVISGYILPVLQRLSGDRLCCKRLPASPLYNSALMEGVRRDLVFLLKENLVAKLLIQDNVVI,DEWSSPVIEYCLCCKGVETGCAAKGFPRVPSTIQPWREEGIWYFCRSRTWQSCFRTETWS

Amino Acids from 3' Exons

VENAKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVEVNSYLS,RMPKIMKIVFYKEKFLPDNPEEDFGKLTIKESAKPLLMMWRLTAIF,RECQRRYSTKRNSCQTIPKKISENLRRAPNHYCGGQLSF