McDonnell Genome Institute

Washington University

CircRNA

chr5|131492581|131521521|-|RAPGEF6|ENST00000296859.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9083

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

7

Peptide

AADSGLKRGDQLPADLTK

Amino Acids from 5' Exons

KMNGHLRLLNIACAAKAKWRQVVLQKASRESPLQFSLNGGSEKGFGIFVEGVEPGSKAADSGLKRGDQ,RMVISGYILPVLQRLSGDRLCCKRLPASPLYNSALMEGVRRDLVFLLKENLVAKLLIQDNVVI,DEWSSPVIEYCLCCKGVETGCAAKGFPRVPSTIQPWREEGIWYFCRSRTWQSCFRTETWS

Amino Acids from 3' Exons

LPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQ,FQLILPRCISQKTLIHRLMCLLVSLVVALPVTLEAAVYLISI,SSSYQDASHRKPSSTGDSCVFSVWLHCQLWKQQFIYLS