top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|131446482|131446703|-|RAPGEF6|ENST00000296859.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.961

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

20

Peptide

LSLSQGSTNSNMLDVQGGAHK

Amino Acids from 5' Exons

VTESRKHKFKHAGCSGRCSQKKGTPQLSACQEAIGCPNGKEGEAVSFQSRCRDRGEVPDDVITVGACIWY,SLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDVETDEEKFQMMSLQWEPAYGT,HVKEAQIQTCWMFREVLTKKGHAAALCLMPRSYMRMPKWQGRSSIFPVSMRQMRRSSRCHYSGSLHMVP

Amino Acids from 3' Exons

VTESRKHKFKHAGCSGRCSQKKGTPQLSACQEAIGCPNGKEGEAVSFQSRCRDRGEVPDDVITVGACIWY,SLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDVETDEEKFQMMSLQWEPAYGT,HVKEAQIQTCWMFREVLTKKGHAAALCLMPRSYMRMPKWQGRSSIFPVSMRQMRRSSRCHYSGSLHMVP

bottom of page