McDonnell Genome Institute

Washington University

CircRNA

chr5|126810179|126819142|+|LMNB1|ENST00000261366.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9886

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

LLEGEEERR

Amino Acids from 5' Exons

EINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAK,RLTRPEGSMKRAWRWILGVKLSMSTSWRKPFMRESNMMPKGCIRRSWSRLTMP,DRDQKEANALGRGGFWASNVVQAGASPSDERATCPSEAVGGAGADLPCQ

Amino Acids from 3' Exons

SRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEE,LEHVWKGFKNRTCLLKKKTTLVACQTKRERWRKGIKCSNSMTMNSFLMSPWTWKSVLTGNSKAKKR,SMFGKDSRIRGLACRKRQLSSHADRQRERDGGNKGSNAATAELTASCKVSPGHGNQCLQETLRRRRRE