McDonnell Genome Institute

Washington University

CircRNA

chr5|126603569|126617333|+|PHAX|ENST00000297540.4

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9813

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

NTPSISEEQIKK

Amino Acids from 5' Exons

KVLGGDSAMRAFQNTATACAPVSHYRAVESVDSSEESFSDSDDDSCLWKRKRQKCFNPPPKPEPFQFGQSSQKPPVAGGKKINNIWGAVLQEQNQDAVATELGILGMEGTIDRSRQSETYNYLLAKKLRKESQEHTKDLDKELDEYMHGGKKMGSKEEENGQGHLKRKRPVKDRLGNRPEMNYKGRYEITAEDSQEKVADEISF,KCVATVLGPSRTRQLHVHQYHIIELLKVWIQVKKVFLIQMMIAVFGNANDRNVLTLLPNQSLFSLARAVRNHLLLEERRLTTYGVLCCRNRIKMQWPLNLVSWEWRALLTEADNPRPTIICLPRNLGRNLKSIQKITRNMNICMVAKKWDQRKRKMGKVISKGNDLSKTGGTDQKTIKVDTRSQRKILKRKWLMKFHS,SARWRQCYEGLPEHGNCMCTSITLSSCKCGFKRKFFFRLSLETQTTEMFPSSQTRAFSVWPEQSETTCCWRKEDQHMGCCAAGTESRCSGHTWYLGNGGHYQKQTIRDLQLFACQETEGISRAYKRSRQGTRIYAWWQKNGIKGRGKWARSSQKETTCQRQAREQTRNELRSIRDHSGRFSRESGNFIQ

Amino Acids from 3' Exons

NGSRRRTPGGVFLNLLKNTPSISEEQIK,MVVEEEHQVEFFISKTLLVSARNKL,WSKKNTRWSFSESLEKHSYQRGTN