McDonnell Genome Institute

Washington University

CircRNA

chr5|126477691|126483574|+|GRAMD3|ENST00000285689.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9671

49

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

DIAVLVLK

Amino Acids from 5' Exons

ISIPAFSVTLIKKTKTALLVPNALIIATVTDR,SLFQLSRPRKPKLLFCQTPSQQSQT,LYSSFLGNPNKENQNCSSSAKRPDHSNSHRQ

Amino Acids from 3' Exons

DFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESENSR,ISMMNSQIWMEWFNKEGKTWKDIAVLVLKLLNLRTLE,FQILRSGWSGSTKKARHGRIQFWFSNSIELS