McDonnell Genome Institute

Washington University

CircRNA

chr5|124644243|124649133|-|ZNF608|ENST00000306315.9

Cancer

Type of Peptide

GBM

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.966

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

4

Peptide

LEGLSGNK

Amino Acids from 5' Exons

DPDSRTWHHYVYQPKYLDQQKSEELDREKKLKEDSPRKTPNKESGVPSLPVSLTSIKEEPKEAKHPDSQSMEESKLKNDDRKTPVNWKDSRGTRVAVSSPMSQHQSYIQYLHAYPYPQMYDPSHPAYRAVSPVLMHSYP,TQIQEHGIIMYTSPNIWISKSQKNLIERRNKRIVRGKLLIKRVVCPAFLYRQALKRSPKRPSILILNQWRRASKMMIERLLTGRTLGEQEWLSPHPVSISHTYSTCMLILTHRCTTPAILHTGLFLPSCTVIL,PRFKNMASLCIPAQISGSAKVRRTREEIKRGSEENSREWCAQPSCIVNKHRGAQRGQASFSINGGEQAEKSKDSCELEGLSGNKSGCLLTHESASVIHTVLACLSLPTDVRPQPSCIPGCFSRPNAQLS

Amino Acids from 3' Exons

VLVTDKPGDERGPGQREESEVCCCCPGLRGQLHRVQRAAEEQRGGQWEREAGQPQCQRTKDTPKLCCGYQSQPFLHQQKEKQASNGAGPELQLGQAWKACPHKFQKHSHYPSRETRDYFFGPRLLFSSVNRLSPPKLQQKVQAHRPEVPPGSCTLRPRKQAGVRAQGQDLGLGRIECGTMQAKHKCICLPVEGTGIPWCWKPTWDPKGKERADEQWPRFHYWCSWEEFWQKEGPQTEQPSSNLQHDGCVRQLLGSRRQFGCDATGSRRINQEKFRRRKGQKSYQLQNGQKPLTEKCPAHCPCPSPHSPAANRYTHCNLYNDHHWDNTRTALPHNNCCSGYTKESSVKTHSTKAHNYGRAHHREPSSGVTQRQKEKGEAKAKGQRRERDGKPKNGCQAGETRGLQGGQQRFTWAFFKGSSQQERAGKWTVGVSGEPHGQYQSGRGLHFHRQRSQPFHRERLEAGMQHFGERAGTNGTSACVDPEWGREFSCKDKQPGLFRHICCRWWFQQVGGYEIKGQFPIRYYFGQCCKRAFFNYSTIISTERVPFSLLPQLSLLFSKLHAPWAGRCPCSWKWEHAGNEDQEGVGRCKERQGRAVRFESGPQFCILTASAPVGDHTKTSCPGSVTLLWPVCIWALYGPEVSDGHQPCLTAVEVLGPEAGRAENGPDWERRLKEKAPLERAGQGGNTEKYAIGHNLKSSLYSGAQKPFTRAISANGDRIAASLQSPAAASGRQLQSADGKPPAYGGCRNEVCHGLYEADRCRPNLEIT,FCESPTSDLEMRGGRGRGKRARSAAAAPGSEASFTESRGLQNKNRGGANGKGRRGSLNASGRRTPPNCAAEDIKASPSSTNKRKNKPPMELDLNSSSEDNKPGKRVRTNSRSTPTTPQGKPETTFLDQGCSSPVLIDCPHPNCNKKYKHINGLRYHQAHAHLDPENKLEFEPDSEDKISDCEEGLSNVALECSEPSTSVSAYDQLKAPASPGAGNPPGTPKGKRELMSNGPGSIIGAKAGKNSGKKKGLNNELNNLPVISNMTAALDSCSAADGSLAAEMPKLEAEGLIDKKNLGDKEKGKKATNCKTDKNLSKLKSARPIAPAPAPTPPQLIAIPTATFTTTTTGTIPGLPSLTTTVVQATPKSPPLKPIQPKPTIMGEPITVNPALVSLKDKKKKEKRKLKDKEGKETGSPKMDAKLGKLEDSKGASKDLPGHFLKDHLNKNEGLANGLSESQESRMASIKAEADKVYTFTDNAPSPSIGSASRLECSTLVNGQAPMAPLHVLTQNGAESSAAKTSSPAYSDISDAADDGGSDSRSEGMRSKASSPSDIISSKDSVVKGHSSTTAQSSQLKESHSPYYHSYDPYYSPSYMHPGQVGAPAAGNSGSTQGMKIKKESEEDAEKKDKAEQLDSKKVDHNSASLQPQHQSVITQRHPALAQSLYYGQYAYGLYMDQKSLMATSPAYRQQYEKYYEDQRLAEQKMAQTGRGDCERKSELPLKELGKEETKQKNMPSATISKAPSTPEPNKNHSKLGPSVPNKTEETGKSQLLSNHQQQLQADSFKAKQMENHQLIKEAVEMKSVMDSMKQTGVDPTSRFKQ,FVSHRQVTWREGAGAEGRERGLLLLPRAPRPASQSPEGCRIRTEGGPMGKGGGAASMPADEGHPQIVLLRISKPALPPPTKGKTSLQWSWTTPALRTISLESVSAQIPEALPLPLKGNQRLLFWTKAALLQCSTVPTQTATKSTSTLTAGTTRLMHTTQKTSWSSSLTVRTRSRTVRKDVMWHLNAVSQAQVYLLMTSRHRHPLVLETHLGPQRERESAMAQVPLLVLKLGRILAKRRALTMNTTFQSPTRLRTVARQQTAVWLLRCLNWKQKDLTRKIEIKKRAKKLPTAKRTKTSLNKVPGPLPLPQPPLPRSSLYPLQPLQRPPLGQYPDCPPSQQLLFRLHQRVLRNPFNQSPQLWESPSPTQLWCHSKTKRKRRSESRTKKGKRREAQKWMPSWGNRTPRGPAKIYLGIFRIISTRMKGWQMDCRSLRRAAWPVSKLRPIRFTLSQTTLPALPGAPRGWNAALWTGRHQWHLCMCPRMGQRVQLQRQAARPIQTYLMLLTMVVLTAGRRVDQRPVPHQILFLVRTVLKGILQLQHNHLNKSPILPITTAMILIILQVTCTLGRSVPLQLEIVGARRERSRRSLRKMLKRKTRQSSILRKWTTILHPYSLSTSRSHKDILPWLSHFIMASMHMGSIWTRSLWPPALPIDSSMRSTMRTRGWQSRKWPRLGEETVKGKVSSPKSWARRKLNRKICHRPQSQKLPLLRSLTKTILNGHQCLIKLRRQVNRSFSPITSSSFRPTASKLSRWKTTSLLRRLKSLSWTLSRQVTQPRDLN