McDonnell Genome Institute

Washington University

CircRNA

chr5|122450532|122451601|+|SNCAIP|ENST00000261367.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9556

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

AFTILTCLQK

Amino Acids from 5' Exons

FTILTCLQKVPVEISRCRFCSQKQARSPRGDSGSWKPVSLQPGTQSKRRFNLTPVIGKGNLRKCLHPGKTVLGIPGCSGFLKFKDPTGEEGTEVSQAETADAEVTEVHRLQQLGPQDYPSEEGPTKAAAHCRKRREYGQRRKPAPDDETHLGIRGTQVSFQHQGLQIPGWPQPISHLREQRTRLRIPVSRLREYSSKPALWPSAAQPQYCCPESCHKSQECPQVSIFQADISELKTESYLGACGADGAAPTEWRKRQRGQDSPADLHKRIGGSTEKAFWSLSIYHGDTKWQPKQLPGSQPAENLYIALDLTWEEDRCQGKPCQLRQRKEG,SPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQPSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDKGRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGNPASSASKGKNKA,HHPHLPPESPSGNLQMQMMILPKASQESKRGFRFLEACQPPAGLDPKQKMKILIKSYASYWERKSQKMSAPRKNCPWNSRMLRLPLEILKRSHWRRGNSPGDSCRGHVSLTQTPTTLRTPRLPQGRLTDQGRSPLKARVWTAQKACTLRNTPWHQGDAGFLSASRPPNPWMATAHLPPQRAANQTNPSIQAQGVFLQTSPLVTLSSPALTVLLPRKLPQVPRVPSSLHLPSVGHLRTNELPLRSLWCRWSSLALNMEKKTKIRAGLSSGPPQVTNRGINKGLLEPFDLSWRHVATKTIIITTRQPTSKPLHCPPHLGGRQMPRETLPAPLAKERIR

Amino Acids from 3' Exons

FTILTCLQKVPVEISRCRFCSQKQARSPRGDSGSWKPVSLQPGTQSKRRFNLTPVIGKGNLRKCLHPGKTVLGIPGCSGFLKFKDPTGEEGTEVSQAETADAEVTEVHRLQQLGPQDYPSEEGPTKAAAHCRKRREYGQRRKPAPDDETHLGIRGTQVSFQHQGLQIPGWPQPISHLREQRTRLRIPVSRLREYSSKPALWPSAAQPQYCCPESCHKSQECPQVSIFQADISELKTESYLGACGADGAAPTEWRKRQRGQDSPADLHKRIGGSTEKAFWSLSIYHGDTKWQPKQLPGSQPAENLYIALDLTWEEDRCQGKPCQLRQRKEG,SPSSPASRKSQWKSPDADDDSVAKSKPGVQEGIQVLGSLSASSRARPKAKDEDSDKILRQLLGKEISENVCTQEKLSLEFQDAQASSRNSKKIPLEKRELKLARLRQLMQRSLSESDTDSNNSEDPKTTPVRKADRPRPQPIVESVESMDSAESLHLMIKKHTLASGGRRFPFSIKASKSLDGHSPSPTSESSEPDLESQYPGSGSIPPNQPSGDPQQPSPDSTAAQKVATSPKSALKSPSSKRRTSQNLKLRVTFEEPVVQMEQPSLELNGEKDKDKGRTLQRTSTSNESGDQLKRPFGAFRSIMETLSGNQNNNNNYQAANQLKTSTLPLTSLGRKTDAKGNPASSASKGKNKA,HHPHLPPESPSGNLQMQMMILPKASQESKRGFRFLEACQPPAGLDPKQKMKILIKSYASYWERKSQKMSAPRKNCPWNSRMLRLPLEILKRSHWRRGNSPGDSCRGHVSLTQTPTTLRTPRLPQGRLTDQGRSPLKARVWTAQKACTLRNTPWHQGDAGFLSASRPPNPWMATAHLPPQRAANQTNPSIQAQGVFLQTSPLVTLSSPALTVLLPRKLPQVPRVPSSLHLPSVGHLRTNELPLRSLWCRWSSLALNMEKKTKIRAGLSSGPPQVTNRGINKGLLEPFDLSWRHVATKTIIITTRQPTSKPLHCPPHLGGRQMPRETLPAPLAKERIR