McDonnell Genome Institute

Washington University

CircRNA

chr5|1208745|1216945|+|SLC6A19|ENST00000304460.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9944

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

LWTCSSGATPPTPRPTR

Amino Acids from 5' Exons

EPSSRSSSCWSWRASPCCTWSSPSGSGCGGAAWVCGAPSTRPRA,SLHDPVPHPAGPGGHPPAVPGVRHRAAAAAGQPGCVELHPPGPEGP,AFMIPFLILLVLEGIPLLYLEFAIGQRLRRGSLGVWSSIHPALKGL

Amino Acids from 3' Exons

EHPDPHQRVRPARQRDPGELCGHAAAVQRLRPRGLRAAGVPDLRHQRLPLR,NILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSE,TSPSSTGSTCLKATPRRTLWTCSSGATPPTPRPTRSWCSRPATSTPSSQ