McDonnell Genome Institute

Washington University

CircRNA

chr5|119220471|119221081|+|DMXL1|ENST00000311085.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9114

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

GASVANR

Amino Acids from 5' Exons

ANRNCIAIASSHDVQELDVSGILATQVYTWVDDDIEVETK,QIETAQSLPVMMFKNWMFLEFWPHRSTLGMMIKWKPK,KKLHSNRFQSCSRTGCFWNSGHTGLHLGRYRSGNQR

Amino Acids from 3' Exons

IRRFLGYTCSFNSCSRYNSIYTQSWHSNQHAMAWYTDWQRSIC,SEDFLVIHARDDLTAVQGTTPYTHSNPGTPINMPWLGSTQTGRGASV,QKISWLYMLVMIQLFKVQLHIHIAILALQSTCHGLVVHRLAEEHL