McDonnell Genome Institute

Washington University

CircRNA

chr5|109344189|109381703|-|PJA2|ENST00000361189.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9815

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LSPFLSQTLCLNLATK

Amino Acids from 5' Exons

LLVRNNAVQSVAVSILRMIQQSCPVTISFTNLVSQFGYK,YWSGTMLSNLLQVYGYSNRVALSPFLSQTLCLNLATK,IGQEQCCPICCSEYIKDDIATELPCHHFFHKPCVSIWLQK

Amino Acids from 3' Exons

QWTKNLVRLSGPNQQEGIRQLQAGDMEEDMLMSVLNHVPDMKEAVGLVMTMKCWNMMFQRKIPQ,NGPRIWGCLAQTSRRVSDNYRQEIWKKTCLCQFTMYDQTKKLRSGWLSVGTRCSKGKFL,MDQESGKAVWPKPAGGYQTITGRRYGRRHAYVSFKPCMTRHERSLGRAGDDYEVLELDDVPKENSS