McDonnell Genome Institute

Washington University

CircRNA

chr5|108883395|108897848|+|FER|ENST00000281092.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9649

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

SVTSMVENVSGR

Amino Acids from 5' Exons

VENVSGRTYANTADAFKQGGGCFGVREENRIFNLEEV,LKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKS,KRRKNLCKHSRCFTRRRLFWSRRELKNLLKLVRRSL

Amino Acids from 3' Exons

YCASAKPKTGTRTETVSPAAEMHSKVFSTEGITRAKSARKWERATSSSKLRRCTISYIY,IVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSM,LCFCAKNRHLKNNSQSSSDALKQSFQHRRNYSKKCKKMMGKSHLQIMKKMHDQLHL