McDonnell Genome Institute

Washington University

CircRNA

chr5|108782662|108798389|+|FER|ENST00000502752.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9202

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

LILNSWAQAICLLWPLR

Amino Acids from 5' Exons

RWGRALLPRLILNSWAQAICLLWPLRVLGLQ,DGVALCCLGSTPGLKQYACFGLSECWDY,MGSRFVAADLELLGSSNMPALASQSAGIT

Amino Acids from 3' Exons

ICADKAHLCSVEDNQCLTKWGLGVTRIHMKQCNCKTGNYGYWKQRNLWPEKVIKNMHLLYRTFVIKLIRKVLSKIMSATYP,YVLIRRLTCAVWRITSALQNGVWEPEEFTSSVKIARLGITVTGNSKEIYGPENKKRICIYFTEPLSSGKYCPNELCQQRIQ,MCLEGSLVQCGGPVPYKMGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQMNYVSNVSK