McDonnell Genome Institute

Washington University

CircRNA

chr5|10411332|10430028|+|MARCH6|ENST00000274140.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

109

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

2

Peptide

LTIISMLEITTLFLWWEK

Amino Acids from 5' Exons

GSSFLFIGRPGRKKQCKSTSQSACSKQRYSCGGRRPSCSPPSHTPAGRACWLSALPPTFKFSTQ,DLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLNFPLR,IFILIYWETRKKMKTVQINKLTIISMLEITTLFLWWEKAFMQPTKPYSSREGLLAFSLTADLIFHS

Amino Acids from 3' Exons

VLLRKCKTSIGGFIHFYWSWYWQFCPSKSASLSAFMNILKMT,CYCGNAKLSPSADLSIFTDGRGIDGNFVLPSPPVAPLTYKQ,VTAEMQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKND