McDonnell Genome Institute

Washington University

CircRNA

chr5|103006800|103025334|+|PAM|ENST00000304400.11

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9533

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

WLSCWPLPYLFGGK

Amino Acids from 5' Exons

VFKLDPNNKEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFSPSGKFITQWGE,CSNWIQTIKKALYSWEGACNQAVTRITSVNPLMWLWIQALEPFMYQMVTATAGLCSFHQVESSSHSGEK,VQTGSKQRRPCINPGKEHATRQPESLLSTHCGCGSRHWSHLCIRWLLQQQDCAVFTKWKVHHTVGR

Amino Acids from 3' Exons

KPRQLLKPKWRTNPPPQNCRRCKRNRNSKSQARECLLFSLQPFWLFRWLSCWPLPYLFGGKNQGPLE,SRGSCNQNGEQTHLLRIAEDARETETDQRARLGSACCSHYNPSGYSGGCPAGHCHIYSVEKIKGLW,AEAVVETKMENKPTSSELQKMQEKQKLIKEPGSGVPVVLITTLLVIPVVVLLAIAIFIRWKKSRAFG