McDonnell Genome Institute

Washington University

CircRNA

chr4|99415477|99429633|-|ADH7|ENST00000209665.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9067

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

ISEGFELLNSGQR

Amino Acids from 5' Exons

VKAEMMSQNLSSWQRNLTWTSLMFYHLKKSVKDLSCSIQDK,FEKQRCPKTSDVPGKEIPGPVDNSCFTIKNQRIAAQFRTK,LKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQ

Amino Acids from 3' Exons

VIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIK,LLNAKQLCFGSRSNPSPLRKKLPHQRLKKFAL,YMQSSCALGAEATLLHGNRSCPTKDRSSH