McDonnell Genome Institute

Washington University

CircRNA

chr4|98421254|98437068|+|RAP1GDS1|ENST00000264572.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9427

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

13

Peptide

YNSMVLICALMGSAEAAEQLGK

Amino Acids from 5' Exons

QKLLNNWERMLSWSVWWNGVKPKIMLVWGSQTDCCLPLYDTVNQ,RSCTIGKECVSGAFGGMVSQRSCWCDGGVKQTAVCPYTTQIK,EAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSK

Amino Acids from 3' Exons

ALLRKIKVLNLYRFYIDCQMREVLLKSNIIPWSYVLLWDL,HCERSRKCTCTDFTTASREKCSNQIFHGPDMCSYGI,TAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLICALMGS