McDonnell Genome Institute

Washington University

CircRNA

chr4|98418656|98420144|+|RAP1GDS1|ENST00000264572.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9669

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

MLIDAQDANCIHMVDNGIVEK

Amino Acids from 5' Exons

MQIVFIWTMGLKNLWIYWTDMKMEMQYSMQHVPSETWPFQ,CKLYSYGRQWDCRKTYGFTGQTCRRWKCNSTACSTKCPQKPGHS,ANCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIP

Amino Acids from 3' Exons

LIKQRCYQLGSQRQFNFLNLKCLLFSSNFWEHECMHK,YKSKDVISWGHRGSFEISINASCSVQTSGNIKNVNRCT,INKAKMLSAGVTEAVLKFLKSEMPPVQFKLLGTLRMLIDAQ