McDonnell Genome Institute

Washington University

CircRNA

chr4|98391951|98418791|+|RAP1GDS1|ENST00000339360.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9305

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

5

Peptide

NLAIPDSLQAQLINMGVIPTLVK

Amino Acids from 5' Exons

IRFKLSLSIWVLFLPNYWASTAKMQLLQKCVLLHLVIQNL,FASSSAYQYGCYSYLSEITGHPLPKCSSYRNVSCCIWFSRT,SLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNLAEL

Amino Acids from 3' Exons

MQIVFIWTMGLKNLWIYWTDMKMEMQYSMQHVPSETWPFQ,CKLYSYGRQWDCRKTYGFTGQTCRRWKCNSTACSTKCPQKPGHS,ANCIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIP