McDonnell Genome Institute

Washington University

CircRNA

chr4|947708|948154|+|TMEM175|ENST00000504505.1

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9973

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

GTAPQAGETR

Amino Acids from 5' Exons

APVTARQRPRHVPAPDPRAGTGYTGGLPPRQERRGRWGGDPVLPTHAQLQRPAVHHRHRHGLYGAPAACPTPSLSRHCPAHLRPVVLPASLGPPAPQAAGGPALPSSPQYCHTQSNKRLLLSCFLLSLCPLRSCLPTRRSPQN,LLPPGSGPAMSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMVCTGPLLRPAPPRASRGTAQPTSDLSRSCQHPWVPQLLRQLRGAQHCPRVPSTATPNPTSVSCSPASFCLFAPSDPACDPHGDLPRT,SCNRQAAAPPCPSPGPQSRHWIHRGTAPQAGETRTLGRGSSAPNACSASVTPCCPSSPPSWSVRGPCLGLPHPEPLEALPSPPQTCLGLASILGSPSSSGSLGGPSTALESPVLPHPIQQASLALLLPSVSLPPQILPVTHTEISPEQ

Amino Acids from 3' Exons

APVTARQRPRHVPAPDPRAGTGYTGGLPPRQERRGRWGGDPVLPTHAQLQRPAVHHRHRHGLYGAPAACPTPSLSRHCPAHLRPVVLPASLGPPAPQAAGGPALPSSPQYCHTQSNKRLLLSCFLLSLCPLRSCLPTRRSPQN,LLPPGSGPAMSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMVCTGPLLRPAPPRASRGTAQPTSDLSRSCQHPWVPQLLRQLRGAQHCPRVPSTATPNPTSVSCSPASFCLFAPSDPACDPHGDLPRT,SCNRQAAAPPCPSPGPQSRHWIHRGTAPQAGETRTLGRGSSAPNACSASVTPCCPSSPPSWSVRGPCLGLPHPEPLEALPSPPQTCLGLASILGSPSSSGSLGGPSTALESPVLPHPIQQASLALLLPSVSLPPQILPVTHTEISPEQ