McDonnell Genome Institute

Washington University

CircRNA

chr4|94270727|94283303|+|SMARCAD1|ENST00000354268.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9499

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

4

Peptide

VGQTNLSLKPYQK

Amino Acids from 5' Exons

FVTQALSEGWFELAGIGTTWTWHFGRN,LSLKPYQKVGLNWLALVHKHGLNGILADEM,CHSSPIRRLVIGWHWYINMDLMAFWQMK

Amino Acids from 3' Exons

DSSNVYRYGYLCVSAINKSWWIRNKSDFSKCCYTSRYLSLQTSRRMPSRPD,IHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQT,FILMSLIPIWISLCFCYQQKLVDEILQQMLLYFTILTVILIMTNKQKIDAIEARL