McDonnell Genome Institute

Washington University

CircRNA

chr4|94233953|94270818|+|SMARCAD1|ENST00000354268.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9399

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

MDLMAFWQMK

Amino Acids from 5' Exons

FAIRRVPRPSYHGTKYFRTGRPFGIGRPRCTSDFEGTFSTKKQFT,SEPSEDEESQGLPTMARRNDDISELEDLSELEDLKDAKLQTLKELFPQRSDNDLLK,LSHLKMKSPKAFLPWHVEMMIFQNWKTFRNWKTLKMLNFRLRNFFHKEVTMIYL

Amino Acids from 3' Exons

FVTQALSEGWFELAGIGTTWTWHFGRN,LSLKPYQKVGLNWLALVHKHGLNGILADEM,CHSSPIRRLVIGWHWYINMDLMAFWQMK