McDonnell Genome Institute

Washington University

CircRNA

chr4|89934809|89936798|+|MMRN1|ENST00000264790.6

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9778

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

NTDNIIYPGLK

Amino Acids from 5' Exons

VNPKALMYETENNLKFFKMTCKRLHSSSRLYQVYQRTSKAPGKFKKLMNLWFQQPSKSLFWCKRIGPLLIWNGITLMGKKLLHVRSLLKNKSRLIKVLNRNTQEAFCIMNPSIKLFLNRKYMSSFYQLNRYQTRRMLQLLSQLAIMSLSTCLLYMKIRSRVCCKCLKICTFKKARLTISPSLWRWRKSLSEVNVKTCYPNAEMILNFNLRTQKRIYMCIKHWLKFSFQWTIRWTKVSNMILMIWRSFNPCLSREHHSDRQHMNNQRKQGKRKILVLSIVILLSKNLQKDTTYLEMKYRVVMMPKDVSMNMPKWKMASIRQLLIMLLISFKITMPKRLVLLRIIVRSIINVPPIWKLFHLFLSSTVMILFRLWSMTIRDITLFCKSPRPLQVFPEMRNISPTSKRCIKCSMKPLPKENTSKIVIWKKNYSLPRFPKILRLGCKTLSLKLPRRSYLIIFQLKKAVLQMREIRLFNCKYIPDLRRWKQNLSIFQLTSFRLTKLSTKFQCVTMLLQVCQNMLPSLSGNIPCQIFNFFRKVQNLWNQFKKLKLPYLILVVIDRCLVVWQMLSSLRSKNHCQRKLTHLRNQRILPQSAGLKETRTTYIL,SKIQKHCTDKRHSKRTINFSKHARDCSTALQDCIKSIRGPRKHQANNSKSICGFNSSPAKVCFGARESAHFDYSGTKESHCECKARNDSYMEAYRTRSKADSFRRCSRTGTLKKHSVLIPQNSFIEGSTAAFINTGIRPEECSSCVSQCHVHVYFTKYKEAEFDDAANVRFAHSRKQDQSHRLFGDGERVSQRMRHVIQMQKFISTGHRREFTCVKSNIGSSLSNGQDGQNEATKFDLYGDPSTLAAGSITQTDNDITTKGSNSDKEKDRKSDCCQSKFYYQRTYKKTQLTKSTGSCLRKTYQICLRNGRWPQDNDYYKCYFHSRLCPKRDFKYYGDPSMYLRYGNYFDIYSSVPPSEFYSDFGQQSEILCFASRQDPCRYSQRETKSVQLPKDVSNVQNHFPSEKIPAKYESFGRKTTLNYQDFQKFDSVARHVSYPDAHTLLYFSKRQCSYKERSGSSTASIKFQIGVGSKIYPSFNLLFAQNSPRSFNNVSQCFYKCVRTECYHPVDKTFPARYSTSSERSNRICGTNNSNKNSSCPIFNLLYRSIVAWSGKCCQVSEASKIIAKENRTETNGKSYHSPDRPDSKKHGQHNIS,LKSKSINVLIRDIVREQFKIFQNDMQETVAQLFKTVSSLSEDLESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKELEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQNMSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLNSRFKALEAKSIHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLPDIQLLQKGLTEFVEPIIQIKTQAALSNLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVNLTTVLIGRTQRNTDNIIYP

Amino Acids from 3' Exons

VNPKALMYETENNLKFFKMTCKRLHSSSRLYQVYQRTSKAPGKFKKLMNLWFQQPSKSLFWCKRIGPLLIWNGITLMGKKLLHVRSLLKNKSRLIKVLNRNTQEAFCIMNPSIKLFLNRKYMSSFYQLNRYQTRRMLQLLSQLAIMSLSTCLLYMKIRSRVCCKCLKICTFKKARLTISPSLWRWRKSLSEVNVKTCYPNAEMILNFNLRTQKRIYMCIKHWLKFSFQWTIRWTKVSNMILMIWRSFNPCLSREHHSDRQHMNNQRKQGKRKILVLSIVILLSKNLQKDTTYLEMKYRVVMMPKDVSMNMPKWKMASIRQLLIMLLISFKITMPKRLVLLRIIVRSIINVPPIWKLFHLFLSSTVMILFRLWSMTIRDITLFCKSPRPLQVFPEMRNISPTSKRCIKCSMKPLPKENTSKIVIWKKNYSLPRFPKILRLGCKTLSLKLPRRSYLIIFQLKKAVLQMREIRLFNCKYIPDLRRWKQNLSIFQLTSFRLTKLSTKFQCVTMLLQVCQNMLPSLSGNIPCQIFNFFRKVQNLWNQFKKLKLPYLILVVIDRCLVVWQMLSSLRSKNHCQRKLTHLRNQRILPQSAGLKETRTTYIL,SKIQKHCTDKRHSKRTINFSKHARDCSTALQDCIKSIRGPRKHQANNSKSICGFNSSPAKVCFGARESAHFDYSGTKESHCECKARNDSYMEAYRTRSKADSFRRCSRTGTLKKHSVLIPQNSFIEGSTAAFINTGIRPEECSSCVSQCHVHVYFTKYKEAEFDDAANVRFAHSRKQDQSHRLFGDGERVSQRMRHVIQMQKFISTGHRREFTCVKSNIGSSLSNGQDGQNEATKFDLYGDPSTLAAGSITQTDNDITTKGSNSDKEKDRKSDCCQSKFYYQRTYKKTQLTKSTGSCLRKTYQICLRNGRWPQDNDYYKCYFHSRLCPKRDFKYYGDPSMYLRYGNYFDIYSSVPPSEFYSDFGQQSEILCFASRQDPCRYSQRETKSVQLPKDVSNVQNHFPSEKIPAKYESFGRKTTLNYQDFQKFDSVARHVSYPDAHTLLYFSKRQCSYKERSGSSTASIKFQIGVGSKIYPSFNLLFAQNSPRSFNNVSQCFYKCVRTECYHPVDKTFPARYSTSSERSNRICGTNNSNKNSSCPIFNLLYRSIVAWSGKCCQVSEASKIIAKENRTETNGKSYHSPDRPDSKKHGQHNIS,LKSKSINVLIRDIVREQFKIFQNDMQETVAQLFKTVSSLSEDLESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKELEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVSNNVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCRNDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLRQTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEYALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFHRLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQNMSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLNSRFKALEAKSIHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLPDIQLLQKGLTEFVEPIIQIKTQAALSNLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVNLTTVLIGRTQRNTDNIIYP