McDonnell Genome Institute

Washington University

CircRNA

chr4|88475840|88504415|+|HERC5|ENST00000264350.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9509

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

TFEKITTCLK

Amino Acids from 5' Exons

ITTCLKDNLLKRLPFHSPPQEALEIFFLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVL,PPASKIICSKDFHFILHPKKLKFSSFSQNVLCIFPTTGRALWFHLQRLFVKVTSLHWFW,NHLPQRSAQKTSISFSTPRSFRNFLPSPRMSYDAYFQQLGEPCGSICKGCLNEPVFTGS

Amino Acids from 3' Exons

ERLCFVYQLHFQRLCKGGLRISERILNVRRRHYQIIPPRRTEGCDCWKYRLLENIK,RDYVSKYINYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTFEK,ETMFLSISITFSTTLRRFMKNFGEDFIKCATKTLSNYSTPKNRMLLEIQIMIGKHLK