McDonnell Genome Institute

Washington University

CircRNA

chr4|88475840|88489336|+|HERC5|ENST00000264350.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9915

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

ELWITTCLK

Amino Acids from 5' Exons

ITTCLKDNLLKRLPFHSPPQEALEIFFLLPECPMMHISNNWESLVVPFAKVVCKMSDQSSLVL,PPASKIICSKDFHFILHPKKLKFSSFSQNVLCIFPTTGRALWFHLQRLFVKVTSLHWFW,NHLPQRSAQKTSISFSTPRSFRNFLPSPRMSYDAYFQQLGEPCGSICKGCLNEPVFTGS

Amino Acids from 3' Exons

SKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELW,VKNIKLILGRQQLRKKESLNSLGPRLIQSEGITLRMFISVNLRMKTGKSY,KTSLSVGSNGRKRVIRFEAHVSNSQKESLDGCFESAKSIERPEERVM