McDonnell Genome Institute

Washington University

CircRNA

chr4|88019457|88038501|+|PKD2|ENST00000237596.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9063

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

NGTASLGNK

Amino Acids from 5' Exons

VSGEQDSWRKAALTERNTLKVFYGNWSHTSFFSSCAS,SLGNKTHGGKQHPREIPKCFTGTGHIPPFSHSLVH,LWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCI

Amino Acids from 3' Exons

FTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGT,SQKAPYWMGCTGRCSPATRLKLTTEVSSSMRTCCGFHEYGNSESEMDPALSPRTEMKLKSAMMSTLSVVKIGLPLGPEMEP,HRRLLIGWAVLEDAAQQPDSQPKFHLLEPAVRGSTNTATPSQKWILLYPPGLERNRVLCLLCQRGSLWAPKWNR