McDonnell Genome Institute

Washington University

CircRNA

chr4|88019457|88036353|+|PKD2|ENST00000506727.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9281

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

LLVCECVPVPLGR

Amino Acids from 5' Exons

VSGEQDSWRKAALTERNTLKVFYGNWSHTSFFSSCAS,SLGNKTHGGKQHPREIPKCFTGTGHIPPFSHSLVH,LWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCI

Amino Acids from 3' Exons

EQSLCEGCWYVNVCRFPWGVHLDLSVFQPTAAPMCTTTPGCHSSSTPPCPKRRKLTLKLCLPWKTSG,NNPFVKAAGMMCAGSLGAFIWIFLCSSDLRHDELQCVLLHPDDVTALPRHPRVQNGENLNSVFHGRLLE,TIPLRLLVCECVPVPLGRSFGSFCVPVTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWK