McDonnell Genome Institute

Washington University

CircRNA

chr4|87131082|87132408|+|AFF1|ENST00000307808.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

VAQAPSPCIAR

Amino Acids from 5' Exons

TDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLI,RTGLERLLSTWKPSCPSLSAELPQSLKASHPSQLTLSTQKLISL,GQGWKGFVPGSRLVLHVRNCHRVKPVIQVSLLCLLRNCRSH

Amino Acids from 3' Exons

HALPVHFEHGDVSLKRHSNKVFSYSTLREFFQSRPGTFSMHCK,MRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIA,CVASPFTWRCFVVKKTQSILVLLINTSRVLPKSPRHLLHALQ