McDonnell Genome Institute

Washington University

CircRNA

chr4|87114366|87127703|+|AFF1|ENST00000307808.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9868

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

AELMPEPPTTNK

Amino Acids from 5' Exons

PEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRK,LSLQQQTNGSWTTGPKSASQLRHQRAPGAQSPHGGTQRVRAAATVPRVRSILNPKILPLKAPAKPPGPHPKPPTPERGAVRSLRHSRSPHKGKPLEPNNPKNLSRPLPGQVHGPACRGKGSQGFFPMAPETRLPKTSPRRRKDGPGPQQATNPSQQCPPPVRRRSTRAPSLPPLRLSQAQNPRRTMWRTGPLSTLLLFPLRARAHPTVAAAAGLVAAAKPWWSRRTAAKTDSHCLETPSCSHRSGTLLPHKAWRSPTCSLGYPSLPGRGAARGKQKINSRPQGRSTALRRGAQTAQASWPKRE,ASNNKQMAAGQLADQSQPASCATRGPQEHRAPTAAPREGQQRQCHESGAFIQRSSPKLQQSPPGPTRSPPPRKEELSEVSGTAGAPTKANRWNQTTQKTCQGLCPGRFTDQPAGGKGARASSLWLPRPDFQRQAQGEDERTAPGRSKQRTQASSAPLQEEEAQELPPCPLGSLRPRTREGQCGGQDPALCSCSPDEPGPTPQWQRQQDWLPPSRGGPGGQPQRQTPIAFERHQAALTAQGHSSPTKLDGEDHPRPALSDTPASREGEPPEESRRTAARREEAQLEEELRQLKQVGQKEK

Amino Acids from 3' Exons

TTSRPSHEGGKKDEAESRVN,QQADLHMREAKKMKQKAELM,NKQTFTGRQKRSRKQS