McDonnell Genome Institute

Washington University

CircRNA

chr4|86771170|86780472|+|PTPN13|ENST00000316707.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9124

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

4

Peptide

AMTPLQSPAQVLPNSSK

Amino Acids from 5' Exons

TPLQSPAQVLPNSSKDSSQPSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWSSALHQTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFED,PHFSLQHKYFQTAVKTLLSHHVWSKAPAQMKMKCQTKAKNSASPHPEETVTVTAVGVEKMTQLQQTYQIRPGVQLCIRLATWYHRHRVIMKHPRVKKIPFVPCFTILRKFPINQSLRT,PTSVSSTSTSKQQRLFSAIMCGAKHQLRKNVRQKQKTVQVPIQKRQLQQQWEWRRLSDSSSKHIKFDLEFSFASDSKQHGITGTESSSTQESRRYHLYHVLLSSENSQTRVGQ

Amino Acids from 3' Exons

KSSSGPQLKEVCCFSSKVNQRQ,NDLPVVPSSKRSAVSAPKSTKGN,MIFQWSPAQRGLLFQLQSQPKAM