McDonnell Genome Institute

Washington University

CircRNA

chr4|85721884|85942273|+|ARHGAP24|ENST00000395184.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9482

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

TQGSSFLK

Amino Acids from 5' Exons

GTIFLPGNKVSEHPCNEENPGKFLFEVVP,VLFFCLEIKFLSIPAMKRTQGSSFLKFQ,YYFSAWKSFASLQREPREVPFSSS

Amino Acids from 3' Exons

AFLDRNWRILFVMRRDMGTVWLRCWWSSAWTLSDKGGKKRVSFDCQARLILLRSSKMPLTVGRSHHLT,HFWTETGGYCSLEEIWEPSGSDVGGAVRGLYPTKGAERRGSLSTARPGSCGAPRCLLWGEAIIQ,IFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD