McDonnell Genome Institute

Washington University

CircRNA

chr4|84809886|84860622|-|WDFY3|ENST00000295888.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

VATDSFDR

Amino Acids from 5' Exons

ALLSVLRESHRSRTVFRKVGGFVYITSLLVAMERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVISIESVSPTLRHCSKLFIYLYKVATDSFD,PSCRSFEKAIVQEQFLGKLEDLCTLHPCSLLWKDLAVHPRMAGRKTRIKCLNFFTLCSARLQQCAMSQPTLISSKQRFSMRSWQMLFDFLAASQTEKAPMSSPQIHSHFKDFRKMSQNQCHPRYGTAVNFLFIFTKPQILLT,PPVGPSRKPSFKNSFESWRICVHYILARCYGKIFELSTQEWLGESEPESSVTSSHCVLHVDCSNALASQLSFLQNRDSVEVGRCCSISWLLLRPKKNKRHECLPLKYTAISKTFRGRCNLNRISVTHVTALQTFYLSLQSSHRFFQ

Amino Acids from 3' Exons

NKCVSPTSQDEHGEEDHGAAEAGGVQPTRQRLRTDAPPPALHGVVPSSPAHDSEGTRRETVYDAASVQ,IRSASHQPAKMNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR,LEVRLTNQPRTWRGSWGGRGRRSAAHKTTPDCTSAGSSRSCAILPGTLRRNKKRNCICCQCLT