McDonnell Genome Institute

Washington University

CircRNA

chr4|84796520|84810344|-|WDFY3|ENST00000295888.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9443

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

AIVQEQFLGK

Amino Acids from 5' Exons

VVSHLWKVWVLIMFLAYMKITITGARAWNLRKEVLYPPGSVWSPQPHMTSDFMGHQLLQLLLNLTHHLKGL,YDHISGRSGYCFLTRPLPDKQEPGKICGRKYCTPDQGEVSGLHDNPTHQTSWVISYSSFCIHITRVW,SMITSLEGLGTDNVFSLHEDNHYRISKSLVKSAEGSTVPLTRVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGF

Amino Acids from 3' Exons

ALLSVLRESHRSRTVFRKVGGFVYITSLLVAMERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVISIESVSPTLRHCSKLFIYLYKVATDSFD,PSCRSFEKAIVQEQFLGKLEDLCTLHPCSLLWKDLAVHPRMAGRKTRIKCLNFFTLCSARLQQCAMSQPTLISSKQRFSMRSWQMLFDFLAASQTEKAPMSSPQIHSHFKDFRKMSQNQCHPRYGTAVNFLFIFTKPQILLT,PPVGPSRKPSFKNSFESWRICVHYILARCYGKIFELSTQEWLGESEPESSVTSSHCVLHVDCSNALASQLSFLQNRDSVEVGRCCSISWLLLRPKKNKRHECLPLKYTAISKTFRGRCNLNRISVTHVTALQTFYLSLQSSHRFFQ