McDonnell Genome Institute

Washington University

CircRNA

chr4|84718421|84803467|-|WDFY3|ENST00000295888.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9477

55

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

EIRDIETLPPK

Amino Acids from 5' Exons

IQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIETLPP,SNTCTAVLESRAIPVRGSFFLVKSIFMLMDLPQQPGKEILKPYLQ,PTHVPLCSSPGPRYQGAPSFWRAFLCDWIYHDSNQGNKRYNLTSK

Amino Acids from 3' Exons

ACISFCFNSPCLPSKCCRPETTCDNFISAEFCSHHSSWSHACHAGPTGLCWVSDTAR,HAYHSVSTPPVYPPKNVADLKLHVTTSSLQSSDAVIIHPGAMLAMLDLLASVGSVTQPE,MHIILFQLPLFTLLKMLPTNYMQLHLCRVLMQSSFILEPCLPCWTYWPLLGQHSQ