McDonnell Genome Institute

Washington University

CircRNA

chr4|84715297|84721572|-|WDFY3|ENST00000295888.8

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9378

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

FSLEMDGITSLLFR

Amino Acids from 5' Exons

PIAVEVFSGDGRNYLLAFQKGIRNKVYQ,LLLWKFSLEMDGITSLLFRKESETKSIK,YCCGSFLWRWTELPPCFSERNQKQSLSK

Amino Acids from 3' Exons

VWSSLLNAPDLHLMEEMRRTRSSYKTRLLRAAPKRRRKQIMLPYCACRKEK,FGQASSKTLPICTWRRGEPGAATRPDCGQLHRRGGENRCYLTAPVRGRRK,LVKPPLKRSRSAPDGGDEENQEQLQDQIAEGSSIEEEEKTDNATLLRLLEEGEK