McDonnell Genome Institute

Washington University

CircRNA

chr4|8394619|8410355|-|ACOX3|ENST00000356406.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9695

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

QEFIIHSPDFEAAK

Amino Acids from 5' Exons

QWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQ,NGACFHIWQLSTPTISPSRSSWTWWSSSEDLHRETAAPD,MALASISGSCLRLRPFLQVALPGPGGAPARTCIGRPQRQT

Amino Acids from 3' Exons

EFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQ,NSSYIPLISKLPSFGLATWARQPLTRWCLLSCVCQGTSAMGCIPLSC,IHHTFPFRSCQVLGWQHGQDSHSRGGVCAVCARGPVPWAASLYRA