McDonnell Genome Institute

Washington University

CircRNA

chr4|83581561|83590292|+|AGPAT9|ENST00000264409.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9874

149

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

LCYGIIQRDESPMEK

Amino Acids from 5' Exons

VLSKEMSHPWKKGSLVYEEGTLSCLTCFISPRRDWKPLKMKPRGFPQRSCHGISSQEPMISSTSVCGSLWCGCWASCAIVSYCL,YYPKRVTHGKRALWSTRKGLAVRVLFLQEGIGSHCRRSDPEVFLRGASVMESPHKNQCKFPVHQSAAHYGVGAGRHSALLCPTASE,IIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPL

Amino Acids from 3' Exons

AVQTPEGRHLCCQPYFPHCFNLDNGWMLCY,QYRPQKGGICVANHTSPIDVLILTTDGCYAM,STDPRREAFVLPTILPPLMFSQRMDVML