McDonnell Genome Institute

Washington University

CircRNA

chr4|83536503|83544602|+|AGPAT9|ENST00000395226.6

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9859

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

VMEGAELAGK

Amino Acids from 5' Exons

RVPGSALCSWSSRGTAWGQGLLWRSALHCGPLLSGCAESWRAQSWPGRSFPPGRWFSASSFYLRSSECLWASPRSTRSKL,GECRARRSAPGAPAGLPGDRDCCGARPSTADLSVGAPSHGGRRAGREDPFHLADAGSRLHPFTFGLRSVSGHLRDLHEDPSENFR,VSAGLGALLLELPRDCLGTGTAVALGPPLRTSPEWVRRVMEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLE

Amino Acids from 3' Exons

WATIRIEKGTPKESILKNSASV,GPQYELKKEPQRSRFLKTLLLL,GHNTNKRNPKGVDSKLCFC