McDonnell Genome Institute

Washington University

CircRNA

chr4|82878729|82881937|-|SEC31A|ENST00000355196.6

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9246

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

ALDVNIFQDEVK

Amino Acids from 5' Exons

VPQVDLGALNGFQRRCLWSSDCRWKWKYYSLSFNYSWRQGSCDCPEQAYWPSESLGCEHFP,YHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQ,TTSFGGLIKWIPKEMSLEFLQVVKMEILFSMILLKLLETRKLLPRMTSILAQEPWMTFS

Amino Acids from 3' Exons

DEVKGSRSYSHAGMEPCPESPHLPSN,MKLKEVDRTAMQAWSPAQNHPIYLAT,SRKIVQPCRHGALPRITPFTQQ