McDonnell Genome Institute

Washington University

CircRNA

chr4|78511273|78513552|+|FRAS1|ENST00000512123.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9616

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LPGSVLHR

Amino Acids from 5' Exons

VLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNIVTIGTDSAICHTPVVAGTSRGFQAQSFIATLKYLDVKHKEHPN,SWTAFTSAGGSMCVVWPRLWTRWAMWGPPGATLLPLEQTVLSATHQWWLGHPEASRLSPSSQPNTWMSNIRSIRT,PGQHLLQPEVPCALCGQGCGQGGPCGDPLKEQHCYHWNRQCYLPHTSGGWDIQRLPGSVLHRNLEIPGCQTGASEQ

Amino Acids from 3' Exons

NPHFGADPTPGWNAAPYLHHAVAQLTFSTVVHLQTPARLLQFSYHLPERHL,IHISVQIPHQDGMLPLISTMPLHNLHFLLSESIYRHQHVCSNLVTTYDLRGIS,STFRCRSHTRMECCPLSPPCRCTTYIFYCLSPSTDTSTSAPILPPMTEASQ