McDonnell Genome Institute

Washington University

CircRNA

chr4|7843138|7872080|-|AFAP1|ENST00000358461.6

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9477

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

2

Peptide

LPAAEEAVRPVDQVALR

Amino Acids from 5' Exons

IMIPMRAALMSRMMKRRRMGRGRKPGTSGPPRRPPWTWSRTPKSAPSCCGRSGSASGPSCSASSKTPNC,LFRCDEQLLVVRGGGWEGEENPAPVALRGGLHGPGQGRQNLRLPAAEEAVRPVDQVALRHQRHQTA,YDSDAMSSSYESYDEEEEDGKGKKTRHQWPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTKLL

Amino Acids from 3' Exons

QWKSLNFVSFLNSWTMNIPQLSGRKRQPTFCEYSHPK,NGRVNSTSSLSTPGPISNLNCQGEKGSDNQHSAKNTVIQ,MEELIVELRLFLELLDHEYLTSTVREKKAVITNILLRIQSSK