McDonnell Genome Institute

Washington University

CircRNA

chr4|7772819|7774903|-|AFAP1|ENST00000358461.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9041

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

SGTSSPQMLPSTSMAR

Amino Acids from 5' Exons

AGSRRRSWRRSSSWRRSAGRRRRSVSAWSWSRRSRRARKRWRAESPWGWPSSPSQGHRVH,QEAAGDPGGEAEAAGGGVPAEGGGACQPGAGADGGQGEPEESAGGRSHPGAGHRAQVRDIEST,RKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQ

Amino Acids from 3' Exons

MLPSTSMARTGKQMPSGYRPKRRSCRGKRPCGIGWPSSARKEKTFERLLKTP,CCPVQVWQEPGRSRCQAATDQRGGAAEEERGPAEAGPAPQGKKRPSSGYSER,AAQYKYGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNA