McDonnell Genome Institute

Washington University

CircRNA

chr4|76174143|76179705|-|SCARB2|ENST00000264896.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.981

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

12

Peptide

MSASARMTVIEWSQVHFLR

Amino Acids from 5' Exons

VSVYYFQLECTGTACLSVSSCRNISQYVRQCRLLYTGKLPGLRSSECQHLQE,SVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKN,QCILLSVTMRVYRDCLPFGIKFLQKYPIRQTMPASVYLRETAWAQEFMSASARM

Amino Acids from 3' Exons

TVIEWSQVHFLREIIEAMLKAYQQKLFVTHTVDELLWGYKDEILSLIHVFRPDISPYFGLFYE,LSSGPRCTSSGRSSRPCKPISRSSLLTQLTNCSGATKMKSCPLSMFSGPISLPILAYSM,CHRVVPGALPQGDHRGHVESLSAEALCDSHSRIALGLQRNLVPYPCFQARYLSLFWPIL