McDonnell Genome Institute

Washington University

CircRNA

chr4|75981371|75982037|-|SDAD1|ENST00000395710.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9075

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

MFLQQYNHYK

Amino Acids from 5' Exons

NILNVCIIIGEKESNFRRAFALLQISHCYPEYLSNFPQEVKDLLSCNHTVLDPDLRM,TSMYASELERKRATSEEPLLCYRLVTATQSTVIFLKRKIFSPAIIPYWIQICE,HPKCMHLNYRREREQLQKSLCFVTDSLLPRVPKFSSRGERSSLLQSYRIGSRSAN

Amino Acids from 3' Exons

FLQQYNHYKSNVEIFKLQPNKPSKELAELVMFMAQ,FYSSIITTNPMWRFSNCNQINPAKNQSWCLWH,STAVSLQIQCGDFQIATKTQQRTSRAGDVYGT